Catalog# Size Unit Price Quantity
RP-1456 50 ug $195.00

Recombinant (E. coli) West Nile N-terminus Envelope Virus (WNV) (E. Coli, >95%, 42 Kda, his-tag)

AntigenMVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK ATRYLVKTESWILRNPGYALE.
Product TypePurified Protein
SpeciesReactivityWNV
SugApplicationsELISA, Western, antibody blocking

Documents

Data Sheet
Related Products