IGF binding proteins (IGFBP1-6)

Catalog# Name Product Type Data Sheet Size Price
IGFBP65-R-10 Recombinant (E. coli) Purified human insulin-like growth factor binding protein 6 (IGFBP-6) protein Recombinant Protein 10 ug $350.00
IGFBP55-R-10 Recombinant (E. coli) Purified human recomb. human insulin-like growth factor binding protein 5 (IGFBP-5) protein Recombinant Protein 10 ug $350.00
RP-694 Recombinant (E.Coli) Human Insulin Like Growth Factor-I Receptor Recombinant Protein 2 ug Contact Sales
IGFBP66-R-10 Recombinant (NSO) Purified Mouse human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control Recombinant Protein 10 ug $350.00
IGFBP76-R-10 Recombinant (Sf21) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control Recombinant Protein 10 ug $350.00
IGFBP25-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein Recombinant Protein 10 ug $350.00
INSL17-A-400 G. Pig Anti-Human Insulin IgG, pure Antibodies 400 ug $850.00
INSL17-S G. Pig Anti-Human Insulin antiserum Antiserum 100 ul $350.00
IGF12-M Monoclonal Anti-Human Insulin Like Growth Factor-1 IgG1, aff pure Antibodies 100 ug $400.00
IGF11-M Monoclonal Anti-Human Insulin Like Growth Factor-1 IgG1, aff pure Antibodies 100 ug $400.00
0370-HCY Homocysteine ELISA kit, 96 tests, Quantitative 1 kit $800.00
IGF16-R-10 Recombinant (E.coli) purified Human Insulin Like Growth Factor-1 (IGF-1) protein Recombinant Protein 10 ug $350.00
INSLM21-N-20 Recombinant Mouse/Rat Insulin Recombinant Protein 20 ug $350.00
INSL16-BTN Recombinant (Yeast) Human Insulin (USP grade)-Biotin Conjugate Recombinant Protein 1 mg $350.00
INSL16-BTN-B Recombinant (Yeast) Human Insulin (USP grade)-Biotin Conjugate Recombinant Protein 1 bulk Contact Sales
INSL18-N-5 Recombinant (Yeast) Human Lispro (Insulin analog) (USP grade) for cell culture and ELISA Recombinant Protein 5 mg $350.00
INSL23-A Anti-Human Insulin (recombinant) IgG, aff pure Primary Antibodies 100 ug $375.00
0035-IA Human Insulin & Insulin Analogs (Lispro/Humalog, Aspart, Glargine, Glulisine, Determir) ELISA Kit, 96 tests, 1 kit $700.00
0030-20-1 Human Insulin-Biotin ELISA Kit, 96 tests, Quantitative, 96 tests, Quantitative ELISA Kit 1 kit $700.00
INSL15-AS Bovine Insulin-agarose affinity support Affinity Support 0.50 ml $250.00
IGFBP35-R-10 Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein Recombinant Protein 10 ug $350.00
IGFBP36-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein Recombinant Protein 10 ug $350.00
IGFBP26-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein Recombinant Protein 10 ug $350.00
0030N Human Insulin ELISA Kit, 96 tests, Quantitative, 96 tests 1 kit $550.00
INSL15-N-10 Bovine pancreas Insulin (~30 USP U/mg) Antigen Peptide 10 mg $350.00
IGFBP45-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein Recombinant Protein 10 ug $350.00
INSL17-N-5 Recombinant (Yeast) Human Glargine (Insulin analog) (USP grade) for cell culture and ELISA Recombinant Protein 5 mg $250.00
IGFBP15-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein Recombinant Protein 10 ug $350.00
IGFBP56-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein Recombinant Protein 10 ug $350.00
IGFBP75-R-10 Recombinant (E. coli) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control Recombinant Protein 10 ug $350.00
INSB22-M Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure Primary Antibodies 100 ul $400.00
INSL20-AS Human+Bovine+Porcine Insulin-agarose affinity support Affinity Support 0.50 ml $350.00
INSL19-N-10 Porcine Insulin (~30 USP U/mg) Antigen Peptide 10 mg $125.00
INSL19-AS Porcine Insulin-agarose affinity support Affinity Support 0.50 ml $350.00
INSL16-AS Recombinant Human Insulin-agarose affinity support Affinity Support 0.50 ml $250.00
INSC35-P Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] Antigen Peptide 500 ug $350.00
INSC23-M Monoclonal Anti-Human Insulin C-peptide IgG, aff pure Primary Antibodies 100 ul $400.00
INSB25-P Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] Antigen Peptide 500 ug $350.00
INSA21-A Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure Primary Antibodies 100 ul $375.00
INSA15-P Mouse/rat/hamster/ Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] Antigen Peptide 500 ug $250.00
IGFBP32-M Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG Primary Antibodies 100 ug $400.00
IRAP11-A Anti-Rat IRAP (Insulin regulated aminopeptidase) IgG #1, aff pure Primary Antibodies 100 ug $375.00
INSL16-M Monoclonal Anti-Human C-peptide IgG, aff pure Primary Antibodies 100 ug $400.00
INSL15-M Monoclonal Anti-Human Insulin C-terminal pentapeptide IgG, aff pure Primary Antibodies 100 ug $400.00
INSL14-M Monoclonal Anti-Human Pro-Insulin IgG, aff pure Primary Antibodies 100 ug $400.00
INSL13-M Monoclonal Anti-Human Insulin IgG, aff pure Primary Antibodies 100 ug $400.00
INSL12-S Anti-Porcine Insulin antiserum Primary Antibodies 100 ul $350.00
INSL11-M Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure Primary Antibodies 100 ug $400.00
INSL16-SET Recombinant Human Insulin (15, 30, 60, 120, 240, 480, 720, and 960 pM, 8 vials 5 ml each) for NMR stds 1 set $350.00
INSL16-S96 Recombinant Human Insulin (96nm, 200 ul/vial) for NMR stds 1 set $350.00
INSL15-S10 Bovine pancreas Insulin (10nM, 1 ml/vial) for NMR stds 1 set $350.00
IGF26-R-10 Recombinant (E.coli) purified Human Insulin Like Growth Factor-2 (IGF-2) protein Recombinant Protein 10 ug $350.00
IGF15-R-10 Recombinant (E.coli) purified Mouse Insulin Like Growth Factor-1 (IGF-1) protein Recombinant Protein 10 ug $350.00
INSL16-N-5 Recombinant (Yeast) Human Insulin (USP grade) for cell culture and ELISA Recombinant Protein 5 mg $350.00
IGFBP73-M Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG Primary Antibodies 100 ug $400.00
IGFBP73-C Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB WB Control 100 ul $250.00
IGFBP72-M Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG Primary Antibodies 100 ug $400.00
IGFBP71-A Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein IgG, aff pure Primary Antibodies 100 ul $375.00
IGFBP63-M Monoclonal Anti-mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure Primary Antibodies 100 ug $400.00
IGFBP63-C Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB WB Control 100 ul $250.00